PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

59069

Common Name

SELMODRAFT_59069

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

SRS

Protein Properties

Length: 123aa MW: 13259.1 Da PI: 9.8167

Description

SRS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
59069	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF702	102.3	8.6e-32	2	59	6	63
DUF702 6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasska 63 a+C++CGnqakkdC+++RCRtCCksr++dC+thvkstWvpaakrrerq+ +aaa + 59069 2 ATCKECGNQAKKDCQFQRCRTCCKSRNYDCSTHVKSTWVPAAKRRERQALEAAAIAAG 59 68*********************************************99998875543 PP
2	DUF702	69.5	1.1e-21	81	123	110	152
DUF702 110 sseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGl 152 ++a+f+cv+v++++dge+e+aYq++v+igGhvfkG+LydqG+ 59069 81 AAQALFKCVKVTGIEDGENEYAYQATVKIGGHVFKGVLYDQGV 123 689**************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05142	4.6E-28	2	59	IPR007818	Protein of unknown function DUF702
TIGRFAMs	TIGR01623	3.1E-26	3	45	IPR006510	Zinc finger, lateral root primordium type 1
Pfam	PF05142	5.2E-19	81	123	IPR007818	Protein of unknown function DUF702
TIGRFAMs	TIGR01624	7.8E-26	81	123	IPR006511	Lateral Root Primordium type 1, C-terminal

Sequence ? help Back to Top
Protein Sequence Length: 123 aa Download sequence Send to blast
GATCKECGNQ AKKDCQFQRC RTCCKSRNYD CSTHVKSTWV PAAKRRERQA LEAAAIAAGQ 60 PRPRSKRTRS LALGGGSSSA AAQALFKCVK VTGIEDGENE YAYQATVKIG GHVFKGVLYD 120 QGV

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269\|PubMed:16740146, ECO:0000269\|PubMed:18835563}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269\|PubMed:18835563}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024534506.1	3e-74	AT-rich interactive domain-containing protein 1B-like, partial
Swissprot	Q94CK9	5e-42	LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBL	D8RSU7	5e-85	D8RSU7_SELML; Uncharacterized protein (Fragment)
STRING	EFJ24923	8e-86	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP1313	15	49

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G21400.1	2e-33	SHI-related sequence3

Link Out ? help Back to Top
Phytozome	59069
Entrez Gene	9656335

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Estornell LH,Landberg K,Cierlik I,Sundberg E SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis. Front Plant Sci, 2018. 9: p. 150 [PMID:29491878]