![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 59650 | ||||||||
| Common Name | SELMODRAFT_49607, SELMODRAFT_59650 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 93aa MW: 10871.8 Da PI: 8.5035 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 117.5 | 7.9e-37 | 1 | 93 | 2 | 94 |
DUF260 2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94
CaaC+++rr+C++ C+la+yfpa+++++f n +klFG+sn+l+ll+++ ++r+++m+sl++eA++r +dPv+G++g+i l+qql++l+ el
59650 1 CAACRFQRRRCSPACPLAKYFPASENQRFMNCKKLFGVSNMLRLLNQVLVKDRDETMQSLMFEADVREQDPVHGCMGIICMLEQQLDKLRREL 93
****************************************************************************************99875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03195 | 3.9E-36 | 1 | 93 | IPR004883 | Lateral organ boundaries, LOB |
| PROSITE profile | PS50891 | 22.423 | 1 | 93 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
CAACRFQRRR CSPACPLAKY FPASENQRFM NCKKLFGVSN MLRLLNQVLV KDRDETMQSL 60 MFEADVREQD PVHGCMGIIC MLEQQLDKLR REL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 5e-30 | 1 | 93 | 12 | 104 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 5e-30 | 1 | 93 | 12 | 104 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002988022.2 | 2e-64 | LOB domain-containing protein 22 | ||||
| Refseq | XP_024533779.1 | 2e-64 | LOB domain-containing protein 22 | ||||
| TrEMBL | D8RNR9 | 8e-62 | D8RNR9_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ10814 | 1e-62 | (Selaginella moellendorffii) | ||||
| STRING | EFJ26128 | 1e-62 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP60 | 16 | 318 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63090.4 | 1e-31 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 59650 |
| Entrez Gene | 9636497 | 9656100 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




