PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

59991

Common Name

SELMODRAFT_49975, SELMODRAFT_59991

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

SBP

Protein Properties

Length: 55aa MW: 6373.22 Da PI: 8.5129

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
59991	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	96.6	2.2e-30	1	55	2	56
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefD 56 CqvegC++dls+ak+yhrrhkvC +hsk+++v v+++eqrfCqqCsrfh lsefD 59991 1 CQVEGCKTDLSSAKDYHRRHKVCAMHSKSAKVSVNNIEQRFCQQCSRFHVLSEFD 55 ******************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03110	6.8E-24	1	55	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	23.726	1	55	IPR004333	Transcription factor, SBP-box
Gene3D	G3DSA:4.10.1100.10	1.7E-29	1	55	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.44E-27	1	55	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 55 aa Download sequence Send to blast
CQVEGCKTDL SSAKDYHRRH KVCAMHSKSA KVSVNNIEQR FCQQCSRFHV LSEFD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	1e-22	1	55	6	60	squamosa promoter-binding protein-like 12
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16095614}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024533070.1	3e-33	squamosa promoter-binding-like protein 17 isoform X1
Swissprot	Q9SMX9	1e-23	SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBL	D8RMG0	3e-32	D8RMG0_SELML; Uncharacterized protein (Fragment)
STRING	EFJ14672	4e-33	(Selaginella moellendorffii)
STRING	EFJ26334	4e-33	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP97	17	230

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47070.1	6e-26	squamosa promoter binding protein-like 1

Link Out ? help Back to Top
Phytozome	59991
Entrez Gene	9645023 \| 9650585

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Chao LM, et al. Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage. Mol Plant, 2017. 10(5): p. 735-748 [PMID:28400323]