PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

676729962

Organism

Sisymbrium irio

Taxonomic ID

3730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium

Family

MYB

Protein Properties

Length: 113aa MW: 13048.2 Da PI: 9.8816

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
676729962	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.4	1.6e-13	10	50	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 W Ede+l+ av ++G+++W++I++ + ++++kqck rw 676729962 10 WRNTEDEILKAAVMKYGKNQWARISALLV-RKSAKQCKARWD 50 9999***********************.*********5 PP
2	Myb_DNA-binding	23.4	1.3e-07	61	103	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 + WT e+ e+l+++ k+l+ W+tIa +g Rt+ +c + + k 676729962 61 KSEWTGEDTEKLLHLAKLLPAQ-WRTIAPIVG--RTPSECLEMYEK 103 578***************99.****8..****776665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.757	1	59	IPR017930	Myb domain
SMART	SM00717	3.0E-9	6	57	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.7E-15	6	58	IPR009057	Homeodomain-like
Pfam	PF00249	1.4E-11	10	51	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.2E-13	10	86	IPR009057	Homeodomain-like
CDD	cd00167	5.63E-10	10	49	No hit	No description
CDD	cd11659	2.94E-25	57	108	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.9E-11	59	106	IPR009057	Homeodomain-like
SMART	SM00717	4.3E-8	60	107	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	8.971	60	109	IPR017930	Myb domain
Pfam	PF00249	1.1E-5	61	104	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 113 aa Download sequence Send to blast
MRIMTKGAVW RNTEDEILKA AVMKYGKNQW ARISALLVRK SAKQCKARWD DHEWLDPSIK 60 KSEWTGEDTE KLLHLAKLLP AQWRTIAPIV GRTPSECLEM YEKLLNAAAC TKH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
5xjc_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
5yzg_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
5z56_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
5z57_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
5z58_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
6ff4_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
6ff7_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
6icz_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
6id0_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
6id1_L	1e-52	2	109	3	108	Cell division cycle 5-like protein
6qdv_O	1e-52	2	109	3	108	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	676729962

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006398166.1	8e-60	cell division cycle 5-like protein
Refseq	XP_016516169.1	6e-61	PREDICTED: cell division cycle 5-like protein, partial
Refseq	XP_019232628.1	7e-60	PREDICTED: cell division cycle 5-like protein
Swissprot	P92948	1e-59	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A1D6N2M2	1e-58	A0A1D6N2M2_MAIZE; CDC5 protein
TrEMBL	A0A1S4DSP6	1e-59	A0A1S4DSP6_TOBAC; cell division cycle 5-like protein
STRING	Lus10043451	3e-60	(Linum usitatissimum)
STRING	XP_006398166.1	3e-59	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16532	9	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	5e-62	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]