PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

676763660

Organism

Sisymbrium irio

Taxonomic ID

3730

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium

Family

MIKC_MADS

Protein Properties

Length: 237aa MW: 27702.4 Da PI: 9.2401

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
676763660	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	93.7	8.4e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fss++kl+e++s 676763660 9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEFIS 59 79***********************************************86 PP
2	K-box	70.4	5.8e-24	71	174	1	99
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK.....nellleqieelqkkekelqeenkaLr 95 yq+ s++++++a++e++q+ +kL + ++nL+++++++lGe+L++L+++eL++Le+++e+ k +R++K + l +qie+++kk+k++q+++k+L 676763660 71 YQTVSDVDVWSAHYERMQETKRKLLETNRNLRTQIKQRLGECLDELDIQELRSLEEEMENTFKLVRERKlgvkkFKSLGNQIETTKKKNKSQQDIQKNLI 170 78899999*********************************************************8522222789********************9 PP K-box 96 kkle 99 ++le 676763660 171 HELE 174 9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	9.7E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.226	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.56E-40	2	80	No hit	No description
PRINTS	PR00404	8.3E-29	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.4E-36	3	94	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.0E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-29	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	7.0E-14	82	173	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.224	84	179	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010093	Biological Process	specification of floral organ identity
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 237 aa Download sequence Send to blast
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD ARVSIIMFSS SNKLHEFISP 60 NTTTKEIIDL YQTVSDVDVW SAHYERMQET KRKLLETNRN LRTQIKQRLG ECLDELDIQE 120 LRSLEEEMEN TFKLVRERKL GVKKFKSLGN QIETTKKKNK SQQDIQKNLI HELELRAEDP 180 HYGLVDNGGD YDSVLGYQIE GSRAYALRFH QNHHHHYPNH ALSAASASDI ITFHLLE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	2e-17	1	61	1	61	MEF2 CHIMERA
6byy_B	2e-17	1	61	1	61	MEF2 CHIMERA
6byy_C	2e-17	1	61	1	61	MEF2 CHIMERA
6byy_D	2e-17	1	61	1	61	MEF2 CHIMERA
6bz1_A	2e-17	1	61	1	61	MEF2 CHIMERA
6bz1_B	2e-17	1	61	1	61	MEF2 CHIMERA
6bz1_C	2e-17	1	61	1	61	MEF2 CHIMERA
6bz1_D	2e-17	1	61	1	61	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269\|PubMed:18417639, ECO:0000269\|PubMed:8565821, ECO:0000269\|PubMed:9489703}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00077	ChIP-seq	Transfer from AT3G54340	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	676763660

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269\|PubMed:11283333, ECO:0000269\|PubMed:19783648}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ372719	0.0	DQ372719.1 Brassica napus APETALA3-3 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006403587.1	1e-168	floral homeotic protein APETALA 3
Refseq	XP_024013671.1	1e-168	floral homeotic protein APETALA 3
Swissprot	P35632	1e-164	AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBL	V4L404	1e-166	V4L404_EUTSA; Uncharacterized protein
STRING	XP_006403587.1	1e-167	(Eutrema salsugineum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5261	27	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G54340.1	1e-155	MIKC_MADS family protein

Publications ? help Back to Top
Furner I,Ellis L,Bakht S,Mirza B,Sheikh M CAUT lines: a novel resource for studies of cell autonomy in Arabidopsis. Plant J., 2008. 53(4): p. 645-60 [PMID:18269574] Jing D, et al. Two ancestral APETALA3 homologs from the basal angiosperm Magnolia wufengensis (Magnoliaceae) can affect flower development of Arabidopsis. Gene, 2014. 537(1): p. 100-7 [PMID:24334124] Zhang Y, et al. A cucumber DELLA homolog CsGAIP may inhibit staminate development through transcriptional repression of B class floral homeotic genes. PLoS ONE, 2014. 9(3): p. e91804 [PMID:24632777] Nakamura Y,Liu YC,Lin YC Floral glycerolipid profiles in homeotic mutants of Arabidopsis thaliana. Biochem. Biophys. Res. Commun., 2014. 450(4): p. 1272-5 [PMID:24984150] Behrend A,Borchert T,Hohe A "The usual suspects"- analysis of transcriptome sequences reveals deviating B gene activity in C. vulgaris bud bloomers. BMC Plant Biol., 2015. 15: p. 8 [PMID:25604890] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Yunus IS, et al. Phosphatidic acid is a major phospholipid class in reproductive organs of Arabidopsis thaliana. Plant Signal Behav, 2015. 10(8): p. e1049790 [PMID:26179579] Sun JJ, et al. CsAP3: A Cucumber Homolog to Arabidopsis APETALA3 with Novel Characteristics. Front Plant Sci, 2016. 7: p. 1181 [PMID:27540391]