![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 676768904 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 105aa MW: 12237.2 Da PI: 9.6332 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 25.7 | 1.5e-08 | 12 | 45 | 4 | 37 |
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEE CS
SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevav 37
+n+s ++tf k + i+ K +ELS+L d++ +v
676768904 12 SNDSSSKTTFEKGKRDIMQKLKELSTLSDIKSCV 45
79999**************************998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 9.377 | 1 | 45 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.06E-8 | 1 | 50 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.5E-5 | 13 | 45 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MSKKQMKLAL FSNDSSSKTT FEKGKRDIMQ KLKELSTLSD IKSCVAKMTH YKQTVDQETM 60 VDEETFLRQQ IAETSEILKK LRNDNRELEM TGVMLQRLVG KIEFQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 676768904 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022159723.1 | 1e-20 | agamous-like MADS-box protein AGL80 | ||||
| Swissprot | Q9FJK3 | 2e-17 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM70 | 28 | 415 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G48670.1 | 8e-20 | AGAMOUS-like 80 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




