![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 676782722 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 52aa MW: 6012.87 Da PI: 4.682 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 54.6 | 3.7e-17 | 5 | 51 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lp+GfrFhPtdeel+++yL ++v + k+++ ++i ++d+ k+ePwdLp
676782722 5 LPAGFRFHPTDEELITHYLSREVLDVKFKA-KAIVDIDLKKSEPWDLP 51
799***************************.88**************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.93E-17 | 3 | 52 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 20.101 | 5 | 52 | IPR003441 | NAC domain |
| Pfam | PF02365 | 5.6E-8 | 6 | 48 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 52 aa Download sequence Send to blast |
MEESLPAGFR FHPTDEELIT HYLSREVLDV KFKAKAIVDI DLKKSEPWDL PG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 676782722 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020251890.1 | 8e-23 | NAC domain-containing protein 79-like | ||||
| Swissprot | Q9FLJ2 | 5e-19 | NC100_ARATH; NAC domain-containing protein 100 | ||||
| TrEMBL | V4MH12 | 1e-24 | V4MH12_EUTSA; Uncharacterized protein | ||||
| STRING | Bostr.26675s0262.1.p | 9e-26 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7967 | 13 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G18400.1 | 8e-25 | NAC domain containing protein 58 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




