PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

678338064

Organism

Utricularia gibba

Taxonomic ID

13748

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia

Family

ZF-HD

Protein Properties

Length: 94aa MW: 10563.6 Da PI: 8.4967

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
678338064	genome	UGSP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	99.5	2.3e-31	27	84	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++vrY eC+kN+Aa+ Gg+avDGC+Efmp geegt +a++CaACgCHRnFHRre++ e 678338064 27 RTVRYGECQKNQAANFGGYAVDGCREFMPG-GEEGTREAFTCAACGCHRNFHRRETSVE 84 579************************9.999*******************9865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-24	1	91	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.9E-29	29	81	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	6.5E-25	30	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.257	31	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MKKRQVVYRR SEDQFPISSA NSAFTARTVR YGECQKNQAA NFGGYAVDGC REFMPGGEEG 60 TREAFTCAAC GCHRNFHRRE TSVEVANNST SQNW

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	678338064

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011098623.1	8e-39	mini zinc finger protein 2
Refseq	XP_011098624.1	8e-39	mini zinc finger protein 2
Swissprot	Q9LJW5	4e-31	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A2G9I408	5e-39	A0A2G9I408_9LAMI; Uncharacterized protein
STRING	EOY03457	2e-36	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-33	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]