PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

678416473

Organism

Utricularia gibba

Taxonomic ID

13748

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia

Family

WRKY

Protein Properties

Length: 148aa MW: 17243.2 Da PI: 9.6087

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
678416473	genome	UGSP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	105.1	3.8e-33	69	127	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+ 678416473 69 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDEGVVVTTYEGMHSHP 127 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	4.3E-34	54	128	IPR003657	WRKY domain
SuperFamily	SSF118290	5.36E-30	61	128	IPR003657	WRKY domain
PROSITE profile	PS50811	30.331	64	129	IPR003657	WRKY domain
SMART	SM00774	6.0E-39	69	128	IPR003657	WRKY domain
Pfam	PF03106	6.0E-27	70	127	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000122	Biological Process	negative regulation of transcription from RNA polymerase II promoter
GO:0010055	Biological Process	atrichoblast differentiation
GO:0032107	Biological Process	regulation of response to nutrient levels
GO:0043620	Biological Process	regulation of DNA-templated transcription in response to stress
GO:0048527	Biological Process	lateral root development
GO:0005634	Cellular Component	nucleus
GO:0001046	Molecular Function	core promoter sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MENYYFQASS SSLPQFPLMD VATNNPIGNQ MDSAGFDAPT RKEGSEKTHK DKEKRPRYAF 60 QTRSQVDILD DGYRWRKYGQ KAVKNNKFPR SYYRCTHQGC NVKKQVQRLS KDEGVVVTTY 120 EGMHSHPVQK SSDNFEHILS QMQIYNSY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-28	59	126	7	74	Probable WRKY transcription factor 4
2lex_A	2e-28	59	126	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00506	DAP	Transfer from AT5G13080	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	678416473

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009372253.1	2e-68	PREDICTED: probable WRKY transcription factor 75
Swissprot	Q9FYA2	5e-56	WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBL	W8E2P5	1e-68	W8E2P5_MALBA; WRKY75
STRING	XP_009372253.1	7e-68	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2204	24	61

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13080.1	2e-58	WRKY DNA-binding protein 75

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Xu L, et al. Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis. Plant Cell Rep., 2012. 31(12): p. 2177-88 [PMID:22890372] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract. Plant Physiol., 2016. 170(4): p. 2432-43 [PMID:26884488] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Zhang S, et al. The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. Plant Physiol., 2017. 173(4): p. 2294-2307 [PMID:28250067] Guo P, et al. A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence. Plant Cell, 2017. 29(11): p. 2854-2870 [PMID:29061866] Zhang L,Chen L,Yu D Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]