![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 678416684 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 94aa MW: 10401.9 Da PI: 10.7627 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 14.3 | 7.3e-05 | 29 | 63 | 21 | 55 |
HHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
HLH 21 eeLrellPkaskapskKlsKaeiLekAveYIksLq 55
++L +llP + ++++ K + +Le+++eY+++Lq
678416684 29 SRLNQLLPRSRRPSASKGAASKVLEETCEYVRNLQ 63
6899*****7688888888899************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.280.10 | 6.1E-5 | 24 | 74 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 4.71E-5 | 29 | 82 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 94 aa Download sequence Send to blast |
MSTGRRRPSS RQSTGNVRIS DDEILLLVSR LNQLLPRSRR PSASKGAASK VLEETCEYVR 60 NLQREVGDLS ERLSLLLSTV DPDSPQAAVI RALI |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 4 | 11 | RRRPSSRQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 678416684 |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004233358.1 | 2e-30 | transcription factor PRE6 isoform X2 | ||||
| Refseq | XP_006357115.1 | 2e-30 | PREDICTED: transcription factor PRE6-like | ||||
| Refseq | XP_015065156.1 | 2e-30 | transcription factor PRE6 | ||||
| Refseq | XP_016559055.1 | 2e-30 | PREDICTED: transcription factor PRE6-like | ||||
| Swissprot | Q9LJX1 | 1e-25 | PRE5_ARATH; Transcription factor PRE5 | ||||
| TrEMBL | A0A2G3D3F3 | 1e-29 | A0A2G3D3F3_CAPCH; Uncharacterized protein | ||||
| STRING | Solyc02g067380.2.1 | 7e-30 | (Solanum lycopersicum) | ||||
| STRING | PGSC0003DMT400017748 | 6e-30 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA353 | 24 | 161 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28857.1 | 6e-28 | bHLH family protein | ||||




