![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 678425599 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 81aa MW: 9024.38 Da PI: 8.9946 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 91.5 | 7.9e-29 | 12 | 66 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
v+Y+eClkNhAa++G +avDGC+Efmp+ ge+g+ aal+CaAC CHRnFH++ v
678425599 12 MVTYEECLKNHAANVGKYAVDGCCEFMPA-GENGSGAALRCAACRCHRNFHKKVVR 66
799*************************9.999*******************9865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 7.0E-10 | 13 | 63 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 8.9E-27 | 13 | 64 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 2.1E-24 | 14 | 63 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 24.73 | 15 | 64 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MNPVPPRRNE RMVTYEECLK NHAANVGKYA VDGCCEFMPA GENGSGAALR CAACRCHRNF 60 HKKVVRHPDS CRCFAKSSNP K |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Essential protein. Putative transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 678425599 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010246148.1 | 6e-24 | PREDICTED: mini zinc finger protein 2-like | ||||
| Swissprot | Q9SB61 | 3e-21 | ZHD2_ARATH; Zinc-finger homeodomain protein 2 | ||||
| TrEMBL | A0A2G9HH18 | 3e-34 | A0A2G9HH18_9LAMI; Uncharacterized protein | ||||
| STRING | Migut.L01769.1.p | 1e-30 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1105 | 24 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G24660.1 | 3e-14 | homeobox protein 22 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




