PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

678440232

Organism

Utricularia gibba

Taxonomic ID

13748

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia

Family

HSF

Protein Properties

Length: 107aa MW: 12154.7 Da PI: 4.3537

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
678440232	genome	UGSP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	81.9	9.4e-26	26	84	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d++++ ++sw ++g +f+v+ + ef+++vLp+yFkh+nf+SFvRQLn+Y 678440232 26 FLTKTYHLVDDPATDAVVSWGDDGATFIVWRPPEFSRDVLPNYFKHNNFSSFVRQLNTY 84 9********************************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	6.2E-28	17	87	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	9.0E-23	22	90	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	4.49E-23	25	84	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	7.5E-22	26	85	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.3E-16	26	49	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.3E-16	64	76	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.3E-16	77	89	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 107 aa Download sequence Send to blast
MAALILDNLD GLFLSLESQK SVPAPFLTKT YHLVDDPATD AVVSWGDDGA TFIVWRPPEF 60 SRDVLPNYFK HNNFSSFVRQ LNTYVNEHSE SCSVFGEWVL LLWFVGL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ldu_A	1e-17	21	84	16	78	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
UniProt	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Cis-element ? help Back to Top
Source	Link
PlantRegMap	678440232

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012838730.1	6e-44	PREDICTED: heat stress transcription factor B-4
Swissprot	Q6Z9C8	6e-36	HFB2B_ORYSJ; Heat stress transcription factor B-2b
Swissprot	Q9C635	2e-36	HSFB4_ARATH; Heat stress transcription factor B-4
TrEMBL	A0A4D9BF94	7e-43	A0A4D9BF94_SALSN; Heat shock transcription factor, other eukaryote
STRING	evm.model.supercontig_49.32	1e-45	(Carica papaya)
STRING	Migut.N02718.1.p	2e-43	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2721	24	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G46264.1	1e-38	heat shock transcription factor B4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Xiang J, et al. Heat shock factor OsHsfB2b negatively regulates drought and salt tolerance in rice. Plant Cell Rep., 2013. 32(11): p. 1795-806 [PMID:23949687]