![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 678460368 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
| Family | CAMTA | ||||||||
| Protein Properties | Length: 105aa MW: 12511.8 Da PI: 11.2281 | ||||||||
| Description | CAMTA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CG-1 | 75.9 | 5.4e-24 | 8 | 53 | 36 | 81 |
CG-1 36 sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevl 81
gsl+L++rk+vryfr+DG++w+kkkdgktv+E+he+LKv+ ++ l
678460368 8 GGSLFLFDRKVVRYFRNDGHNWRKKKDGKTVKEAHERLKVDIIQHL 53
69***************************************99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51437 | 29.596 | 1 | 98 | IPR005559 | CG-1 DNA-binding domain |
| SMART | SM01076 | 8.1E-6 | 2 | 70 | IPR005559 | CG-1 DNA-binding domain |
| Pfam | PF03859 | 8.8E-18 | 8 | 53 | IPR005559 | CG-1 DNA-binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MIYVHLLGGS LFLFDRKVVR YFRNDGHNWR KKKDGKTVKE AHERLKVDII QHLLRDRTAR 60 HVYRILTRMP SFRLEVWMFC TATMLMERSR KIFAGVATGC LKSTN |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 678460368 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012437208.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
| Refseq | XP_012437209.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
| Refseq | XP_012437210.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
| Refseq | XP_012437211.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3 isoform X2 | ||||
| Refseq | XP_016738097.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
| Refseq | XP_016738099.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
| Refseq | XP_016738100.1 | 5e-20 | PREDICTED: calmodulin-binding transcription activator 3-like isoform X2 | ||||
| TrEMBL | A0A438KPN7 | 5e-26 | A0A438KPN7_VITVI; Calmodulin-binding transcription activator 3 | ||||
| STRING | XP_002519355.1 | 2e-24 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3932 | 20 | 37 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64220.2 | 7e-22 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains | ||||




