![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 678460884 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 178aa MW: 20536.3 Da PI: 10.1628 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 168.3 | 2.5e-52 | 14 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
lppGfrF Ptdeel+v+yL++kv+g +++l +i e+d+yk++Pw+Lp k+ +ekewyfFs+r++ky++g+r+nr++ +gyWkatg+dk++++ +g++v
678460884 14 LPPGFRFFPTDEELLVQYLCRKVAGYQFSL-PIIGEIDLYKFNPWELPDKALFGEKEWYFFSPRERKYPNGSRPNRVAGAGYWKATGTDKTIMT-EGRKV 111
79**************************99.88***************8777899***************************************.999** PP
NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
g+kk Lvfy g+ap+g+kt+W+mheyrl
678460884 112 GIKKALVFYVGKAPNGSKTNWIMHEYRL 139
**************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.28E-67 | 8 | 162 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 60.053 | 14 | 162 | IPR003441 | NAC domain |
| Pfam | PF02365 | 8.4E-26 | 15 | 139 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 178 aa Download sequence Send to blast |
MVARDSDPRN QLHLPPGFRF FPTDEELLVQ YLCRKVAGYQ FSLPIIGEID LYKFNPWELP 60 DKALFGEKEW YFFSPRERKY PNGSRPNRVA GAGYWKATGT DKTIMTEGRK VGIKKALVFY 120 VGKAPNGSKT NWIMHEYRLS DSGKKNSSKR LDDWVLCRIY MKSTGGRKAV SHEFSHGX |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 5e-96 | 1 | 168 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 5e-96 | 1 | 168 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 5e-96 | 1 | 168 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 5e-96 | 1 | 168 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 5e-96 | 1 | 168 | 7 | 174 | NAC domain-containing protein 19 |
| 3swm_B | 5e-96 | 1 | 168 | 7 | 174 | NAC domain-containing protein 19 |
| 3swm_C | 5e-96 | 1 | 168 | 7 | 174 | NAC domain-containing protein 19 |
| 3swm_D | 5e-96 | 1 | 168 | 7 | 174 | NAC domain-containing protein 19 |
| 3swp_A | 5e-96 | 1 | 168 | 7 | 174 | NAC domain-containing protein 19 |
| 3swp_B | 5e-96 | 1 | 168 | 7 | 174 | NAC domain-containing protein 19 |
| 3swp_C | 5e-96 | 1 | 168 | 7 | 174 | NAC domain-containing protein 19 |
| 3swp_D | 5e-96 | 1 | 168 | 7 | 174 | NAC domain-containing protein 19 |
| 4dul_A | 5e-96 | 1 | 168 | 4 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 5e-96 | 1 | 168 | 4 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 678460884 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019264575.1 | 1e-100 | PREDICTED: NAC domain-containing protein 72-like | ||||
| Swissprot | A0A3Q7HH64 | 1e-97 | JA2L_SOLLC; NAC domain-containing protein JA2L | ||||
| TrEMBL | A0A385ZAB8 | 9e-99 | A0A385ZAB8_VACCO; NAC072 | ||||
| STRING | cassava4.1_010991m | 2e-98 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3122 | 24 | 52 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G27410.2 | 3e-98 | NAC family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




