PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

678461853

Organism

Utricularia gibba

Taxonomic ID

13748

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia

Family

HSF

Protein Properties

Length: 144aa MW: 16536.9 Da PI: 4.3409

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
678461853	genome	UGSP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	74.6	1.8e-23	62	120	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k++++++d++l+ +isw g+sfvv+d+ efa+++Lp+ Fkh+nf+SFvRQLn+Y 678461853 62 FLSKTFDLISDSSLDAIISWGPLGQSFVVWDPVEFARTILPRNFKHNNFSSFVRQLNTY 120 9*********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46785	2.86E-21	58	121	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	2.1E-20	58	139	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Gene3D	G3DSA:1.10.10.10	9.6E-25	59	121	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	6.8E-20	62	120	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.7E-13	62	85	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.7E-13	100	112	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.7E-13	113	125	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 144 aa Download sequence Send to blast
MDSDDSKYPF FEPFFGYPAF EHVEHQFETK PGFEEEQGSG MEGSLVAPRP MEALFVNPIP 60 PFLSKTFDLI SDSSLDAIIS WGPLGQSFVV WDPVEFARTI LPRNFKHNNF SSFVRQLNTY 120 VGTVVSFFVY WLLCVFEIHL ILVI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	2e-18	38	120	4	87	Heat shock factor protein 1
5d5v_B	2e-18	38	120	4	87	Heat shock factor protein 1
5d5v_D	2e-18	38	120	4	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269\|PubMed:17999647, ECO:0000269\|PubMed:18261981}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	678461853

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:17999647, ECO:0000269\|PubMed:18261981}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010092004.2	6e-38	heat stress transcription factor A-3
Refseq	XP_010096858.2	6e-38	heat stress transcription factor A-3
Refseq	XP_011094419.1	4e-36	heat stress transcription factor A-2c isoform X1
Refseq	XP_011101504.1	1e-35	heat stress transcription factor A-3-like
Swissprot	Q8GYY1	3e-32	HSFA3_ARATH; Heat stress transcription factor A-3
TrEMBL	A0A2G9GXE8	2e-42	A0A2G9GXE8_9LAMI; Uncharacterized protein
STRING	XP_010092004.1	2e-37	(Morus notabilis)
STRING	XP_010096858.1	2e-37	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA572	24	113

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G03720.1	8e-27	heat shock transcription factor A3

Publications ? help Back to Top
Jung HS, et al. Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Hu Z, et al. Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis. Plant J., 2015. 84(6): p. 1178-91 [PMID:26576681] Song C,Chung WS,Lim CO Overexpression of Heat Shock Factor Gene HsfA3 Increases Galactinol Levels and Oxidative Stress Tolerance in Arabidopsis. Mol. Cells, 2016. 39(6): p. 477-83 [PMID:27109422] Kim GD,Cho YH,Lee BH,Yoo SD STABILIZED1 Modulates Pre-mRNA Splicing for Thermotolerance. Plant Physiol., 2017. 173(4): p. 2370-2382 [PMID:28223317] Song C,Lee J,Kim T,Hong JC,Lim CO VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis. Planta, 2018. 247(6): p. 1439-1448 [PMID:29536220]