![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 678466617 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 115aa MW: 13173.5 Da PI: 7.3657 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 131.9 | 2.1e-41 | 37 | 112 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cqv++C+a+l++ak yhrrhkvCe+h+ka++vl++g +qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk++
678466617 37 CQVDDCTANLTSAKLYHRRHKVCEFHAKAAAVLLQGSQQRFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKST 112
**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.1E-34 | 30 | 98 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.693 | 34 | 111 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.66E-37 | 36 | 114 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 2.1E-33 | 37 | 110 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MERDKYCETG DEDEAAEDEE SSWVAASKPG SSQPRSCQVD DCTANLTSAK LYHRRHKVCE 60 FHAKAAAVLL QGSQQRFCQQ CSRFHELSEF DDSKRSCRRR LAGHNERRRK STCDS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 1e-39 | 29 | 110 | 3 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 678466617 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009622641.1 | 1e-42 | PREDICTED: squamosa promoter-binding protein 1 | ||||
| Refseq | XP_011096328.1 | 9e-43 | squamosa promoter-binding protein 1 | ||||
| Refseq | XP_016433751.1 | 1e-42 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
| Swissprot | Q38741 | 6e-43 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | A0A2G9GQ12 | 1e-43 | A0A2G9GQ12_9LAMI; Squamosa promoter-binding-like protein | ||||
| STRING | XP_009622640.1 | 4e-42 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 1e-41 | squamosa promoter binding protein-like 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




