PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

69246

Common Name

SELMODRAFT_450085, SmHAP3C-2

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

NF-YB

Protein Properties

Length: 88aa MW: 10062.7 Da PI: 8.8994

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
69246	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	125.1	2.7e-39	1	87	2	88
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 +++dr+lPian+++imk+vlP n+k++kdak++vqecvsefi fvt+ a+d+c +ekrktingdd+l al +lGf +++e ++vy++ 69246 1 KDKDRHLPIANIGKIMKRVLPDNSKMTKDAKDLVQECVSEFICFVTGIAADRCTKEKRKTINGDDILKALQQLGFAEHAEIVRVYFE 87 689**********************************************************************************87 PP
2	NF-YC	25.3	3.1e-08	3	72	17	85
NF-YC 17 knhelPlarikkilka.dedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtr 85 k+++lP+a i ki+k +d ++++ +a l+ fi +t + ++ + kr+t++ di +a+++ 69246 3 KDRHLPIANIGKIMKRvLPDNSKMTKDAKDLVQECVSEFICFVTGIAADRCTKEKRKTINGDDILKALQQ 72 789*********96269********************************************99886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	7.6E-38	1	87	IPR009072	Histone-fold
SuperFamily	SSF47113	1.47E-30	4	86	IPR009072	Histone-fold
Pfam	PF00808	1.5E-25	6	70	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.3E-12	34	52	No hit	No description
PRINTS	PR00615	1.3E-12	53	71	No hit	No description
PRINTS	PR00615	1.3E-12	72	88	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
KDKDRHLPIA NIGKIMKRVL PDNSKMTKDA KDLVQECVSE FICFVTGIAA DRCTKEKRKT 60 INGDDILKAL QQLGFAEHAE IVRVYFER

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-33	1	88	2	89	Transcription factor HapC (Eurofung)
4g92_B	2e-33	1	88	2	89	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU019901	1e-127	Selaginella moellendorffii CCAAT-box binding factor HAP3-like protein (HAP3C1) mRNA, partial cds

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002969754.1	3e-60	nuclear transcription factor Y subunit B-10
Swissprot	Q9FGJ3	3e-35	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
Swissprot	Q9SLG0	1e-35	NFYB1_ARATH; Nuclear transcription factor Y subunit B-1
TrEMBL	D8RFJ7	6e-59	D8RFJ7_SELML; CCAAT-box binding factor HAP3
STRING	EFJ28878	1e-59	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP168	17	170

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G38880.6	4e-38	nuclear factor Y, subunit B1

Link Out ? help Back to Top
Phytozome	69246
Entrez Gene	9645381

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]