PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

69405

Common Name

SELMODRAFT_69405, WRKY_24

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

WRKY

Protein Properties

Length: 82aa MW: 9852.22 Da PI: 10.7156

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
69405	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	103.9	8.9e-33	25	82	1	58
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 +dDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers++d ++v++tYeg H+h 69405 25 MDDGYRWRKYGQKAVKNSPYPRSYYRCTYTKCHVKKRVERSSKDSSLVITTYEGVHTH 82 69*******************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.6E-33	11	82	IPR003657	WRKY domain
SuperFamily	SSF118290	3.53E-29	18	82	IPR003657	WRKY domain
PROSITE profile	PS50811	29.528	20	82	IPR003657	WRKY domain
SMART	SM00774	4.3E-33	25	82	IPR003657	WRKY domain
Pfam	PF03106	1.8E-26	26	82	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 82 aa Download sequence Send to blast
PRRKGKKRSH QPRYAIQTKS DKEIMDDGYR WRKYGQKAVK NSPYPRSYYR CTYTKCHVKK 60 RVERSSKDSS LVITTYEGVH TH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ayd_A	5e-27	13	82	2	71	WRKY transcription factor 1
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	5	9	KKRSH

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002988797.2	3e-51	probable WRKY transcription factor 23
Swissprot	Q9C983	3e-36	WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBL	D8R084	9e-53	D8R084_SELML; Uncharacterized protein WRKY_24 (Fragment)
STRING	EFJ34931	1e-53	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP14	17	875

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69310.2	1e-38	WRKY DNA-binding protein 57

Link Out ? help Back to Top
Phytozome	69405
Entrez Gene	9654837

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jiang Y,Qiu Y,Hu Y,Yu D Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa. Front Plant Sci, 2016. 7: p. 145 [PMID:26904091] Jiang Y,Yu D The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]