![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 69431 | ||||||||
| Common Name | SELMODRAFT_49409, SELMODRAFT_69423, SELMODRAFT_69431, WRKY_1, WRKY_14, WRKY_30 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 87aa MW: 10133.5 Da PI: 10.6288 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 105.8 | 2.3e-33 | 30 | 87 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
+dDg++WrKYGqK vk+s++prsYYrCt ++Cpvkk+vers edp +v++tYeg+H+h
69431 30 MDDGFRWRKYGQKAVKNSPHPRSYYRCTNSKCPVKKRVERSCEDPGIVITTYEGTHTH 87
69*******************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.3E-35 | 15 | 87 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 4.71E-30 | 22 | 87 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.262 | 25 | 87 | IPR003657 | WRKY domain |
| SMART | SM00774 | 6.0E-34 | 30 | 87 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.6E-27 | 31 | 87 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
ASRAKPPKKG PKRNREPRYA LQTRSDVDIM DDGFRWRKYG QKAVKNSPHP RSYYRCTNSK 60 CPVKKRVERS CEDPGIVITT YEGTHTH |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 6e-28 | 20 | 87 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 6e-28 | 20 | 87 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002961159.2 | 8e-53 | WRKY transcription factor WRKY24 isoform X2 | ||||
| Refseq | XP_002994359.2 | 7e-53 | WRKY transcription factor WRKY24 | ||||
| Swissprot | Q9C983 | 6e-38 | WRK57_ARATH; Probable WRKY transcription factor 57 | ||||
| TrEMBL | D8QN56 | 4e-58 | D8QN56_SELML; Uncharacterized protein WRKY_14 (Fragment) | ||||
| STRING | EFJ04574 | 7e-59 | (Selaginella moellendorffii) | ||||
| STRING | EFJ31448 | 7e-59 | (Selaginella moellendorffii) | ||||
| STRING | EFJ38698 | 7e-59 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP14 | 17 | 875 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69310.2 | 3e-40 | WRKY DNA-binding protein 57 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 69431 |
| Entrez Gene | 9634707 | 9642250 | 9648480 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




