![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 69510 | ||||||||
| Common Name | HANb-1, HANb-2, SELMODRAFT_107936, SELMODRAFT_451362 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 59aa MW: 6125.87 Da PI: 10.0217 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 61.7 | 9.1e-20 | 16 | 50 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++Cg+tkTplWR+gp g+k+LCnaCG++y+k g+
69510 16 CTQCGATKTPLWRNGPCGPKSLCNACGIRYKKVGS 50
********************************875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 4.75E-15 | 10 | 53 | No hit | No description |
| PROSITE profile | PS50114 | 14.417 | 10 | 59 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 3.5E-13 | 10 | 59 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.5E-16 | 14 | 50 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.11E-11 | 15 | 56 | No hit | No description |
| Pfam | PF00320 | 1.5E-17 | 16 | 49 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 16 | 41 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 59 aa Download sequence Send to blast |
SSSEMSPGAT SPSRSCTQCG ATKTPLWRNG PCGPKSLCNA CGIRYKKVGS TKRTSNSSD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that regulates organogenesis during transition from the vegetative to the reproductive phase. Regulates the expression of CYP78A11/PLA1, HD3A and MADS1 during reproductive development in rice. May act upstream of CYP78A11/PLA1 during panicle development. Acts independently of the photoperiodic and gibberellin signaling pathways. {ECO:0000269|PubMed:19337211}. | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. Regulates both flower and shoot apical meristem (SAM) development, especially for establishing organ boundaries in shoots and flowers, probably by controlling the number and position of WUS-expressing cells (PubMed:23335616, PubMed:25077795). {ECO:0000250, ECO:0000269|PubMed:23335616, ECO:0000269|PubMed:25077795}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by HAN. {ECO:0000269|PubMed:23335616}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002978035.2 | 2e-34 | GATA transcription factor 15 | ||||
| Refseq | XP_024526836.1 | 2e-34 | GATA transcription factor 15 | ||||
| Swissprot | Q6L5E5 | 1e-12 | GAT15_ORYSJ; GATA transcription factor 15 | ||||
| Swissprot | Q6QPM2 | 9e-13 | GAT19_ARATH; GATA transcription factor 19 | ||||
| Swissprot | Q8LG10 | 6e-13 | GAT15_ARATH; GATA transcription factor 15 | ||||
| Swissprot | Q9ZPX0 | 8e-13 | GAT20_ARATH; GATA transcription factor 20 | ||||
| TrEMBL | D8R4U4 | 4e-33 | D8R4U4_SELML; Uncharacterized protein HANb-1 | ||||
| STRING | EFJ20692 | 7e-34 | (Selaginella moellendorffii) | ||||
| STRING | EFJ32731 | 7e-34 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G06740.1 | 3e-15 | GATA transcription factor 15 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 69510 |
| Entrez Gene | 9652528 | 9658148 |




