PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 69566
Common NameSELMODRAFT_69566, SELMODRAFT_69567
Organism
Selaginella moellendorffii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GATA
Protein Properties Length: 67aa    MW: 7606.78 Da    PI: 11.3093
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
69566genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.61.1e-20337135
   GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
           Cs+C+t kTp+WR gp g+ktLCnaCG+++++ +l
  69566  3 CSHCQTQKTPQWRAGPLGPKTLCNACGVRFKSGRL 37
           *******************************9986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004017.1E-13147IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.004133IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.1E-16135IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.43E-15261No hitNo description
CDDcd002029.69E-12249No hitNo description
PROSITE patternPS003440328IPR000679Zinc finger, GATA-type
PfamPF003202.5E-18337IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
RKCSHCQTQK TPQWRAGPLG PKTLCNACGV RFKSGRLLPE YRPAGSPSFV SDKHSNSHRK  60
VLEMRRQ
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024528035.19e-42glutamic acid-rich protein-like
RefseqXP_024530641.11e-41glutamic acid-rich protein-like
SwissprotO497413e-35GATA2_ARATH; GATA transcription factor 2
SwissprotO497433e-35GATA4_ARATH; GATA transcription factor 4
SwissprotO826323e-35GATA9_ARATH; GATA transcription factor 9
SwissprotP697816e-35GAT12_ARATH; GATA transcription factor 12
TrEMBLD8QND42e-42D8QND4_SELML; Uncharacterized protein (Fragment)
STRINGEFJ317763e-43(Selaginella moellendorffii)
STRINGEFJ380823e-43(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-37GATA transcription factor 4
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]
  4. Jiang K,Yung V,Chiba T,Feldman LJ
    Longitudinal patterning in roots: a GATA2-auxin interaction underlies and maintains the root transition domain.
    Planta, 2018. 247(4): p. 831-843
    [PMID:29249045]