![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 69579 | ||||||||
| Common Name | SELMODRAFT_69578, SELMODRAFT_69579 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 116aa MW: 13250.4 Da PI: 4.9598 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 164.5 | 1.4e-51 | 3 | 95 | 9 | 101 |
NF-YC 9 qiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
+++++ dfk h+lPlarikki+kadedv+mis eaPvl++kace+fileltlr+w+h+eenkrrtl+k+diaaavtrtdifdflvdivpr+++
69579 3 EVQEVMDFKTHSLPLARIKKIMKADEDVRMISGEAPVLFAKACEMFILELTLRAWMHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDV 95
67899*************************************************************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 3.29E-31 | 6 | 86 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.1E-23 | 14 | 77 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-38 | 15 | 92 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MQEVQEVMDF KTHSLPLARI KKIMKADEDV RMISGEAPVL FAKACEMFIL ELTLRAWMHT 60 EENKRRTLQK NDIAAAVTRT DIFDFLVDIV PREDVKDEAL GVSRSALPIG APDMQY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 7e-55 | 1 | 92 | 4 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 64 | 70 | RRTLQKN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024529991.1 | 2e-81 | nuclear transcription factor Y subunit C-2 | ||||
| Refseq | XP_024531272.1 | 2e-81 | nuclear transcription factor Y subunit C-2 | ||||
| Swissprot | Q8LCG7 | 1e-62 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
| TrEMBL | D8REN4 | 9e-80 | D8REN4_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ28198 | 2e-80 | (Selaginella moellendorffii) | ||||
| STRING | EFJ29692 | 2e-80 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP315 | 17 | 117 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 4e-65 | nuclear factor Y, subunit C2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 69579 |
| Entrez Gene | 9632992 | 9659762 |




