PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

69621

Common Name

SELMODRAFT_49261, SELMODRAFT_69621

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

LBD

Protein Properties

Length: 102aa MW: 11685.5 Da PI: 8.3727

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
69621	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	123.6	1e-38	4	101	1	98
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 aCaaCk++rrkC+ dC+lapyfpae +++f ++lFG+sn+l++l+++++ ++e++m+sl+yeAe+r +dPv+G++g+i++l+++++ l+ el+l++ 69621 4 ACAACKFQRRKCPVDCPLAPYFPAEANQRFLSCKRLFGVSNMLRFLRDADPADKEETMKSLIYEAEVRDKDPVHGCYGIISQLTERVRGLQRELELTR 101 7********************************************************************************************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	24.302	3	102	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	5.7E-38	4	101	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009556	Biological Process	microsporogenesis
GO:0009786	Biological Process	regulation of asymmetric cell division
GO:0005634	Cellular Component	nucleus

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
TSQACAACKF QRRKCPVDCP LAPYFPAEAN QRFLSCKRLF GVSNMLRFLR DADPADKEET 60 MKSLIYEAEV RDKDPVHGCY GIISQLTERV RGLQRELELT RS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-28	5	102	12	109	LOB family transfactor Ramosa2.1
5ly0_B	2e-28	5	102	12	109	LOB family transfactor Ramosa2.1
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002986599.2	6e-72	LOB domain-containing protein 22
Refseq	XP_024525621.1	6e-72	LOB domain-containing protein 22
Swissprot	Q9STS6	3e-31	LBD27_ARATH; LOB domain-containing protein 27
TrEMBL	D8R2Q3	1e-69	D8R2Q3_SELML; Uncharacterized protein (Fragment)
STRING	EFJ12456	2e-70	(Selaginella moellendorffii)
STRING	EFJ34109	2e-70	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP60	16	318

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G47870.1	1e-33	LOB domain-containing protein 27

Link Out ? help Back to Top
Phytozome	69621
Entrez Gene	9658762 \| 9659085

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Kim MJ,Kim M,Kim J Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis. Plant Signal Behav, 2015. 10(8): p. e1044193 [PMID:26252070] Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310]