PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 69980
Common NameMADS10-2, SELMODRAFT_450991
Organism
Selaginella moellendorffii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family M-type_MADS
Protein Properties Length: 63aa    MW: 7222.59 Da    PI: 10.0644
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
69980genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.29e-23959151
            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
            krien+  r+ tf+kR+ g+ KKA+EL +LCd+++a+i+fs+ ++l  y+s
   69980  9 KRIENSVSRHATFAKRKIGLVKKAQELATLCDIDIALIMFSPVDHLIHYPS 59
            79*********************************************9986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-28160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.348161IPR002100Transcription factor, MADS-box
CDDcd001209.58E-25259No hitNo description
SuperFamilySSF554556.15E-23260IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-20323IPR002100Transcription factor, MADS-box
PfamPF003195.5E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRVKLEIKR IENSVSRHAT FAKRKIGLVK KAQELATLCD IDIALIMFSP VDHLIHYPSD  60
LKY
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM9998061e-99Selaginella moellendorffii mRNA for MADS2 protein, allele 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024531123.18e-37agamous-like MADS-box protein AGL104
RefseqXP_024539268.13e-37agamous-like MADS-box protein AGL104
SwissprotQ9LM466e-21AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLD8S4X42e-36D8S4X4_SELML; Type II MIKC* MADS-domain transcription factor
STRINGEFJ205003e-37(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.12e-23AGAMOUS-like 104
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]