PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

71305

Common Name

SELMODRAFT_71305

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

NAC

Protein Properties

Length: 154aa MW: 17976.5 Da PI: 10.1255

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
71305	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	146.1	1.8e-45	1	124	3	128
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktL 106 pGfrF+Pt+eelv++yL+ kv+gk + vi +vd y+++Pw+L + +++k yfF++rd+ky+ g+r++r+++sgyWkatg+d++v + +g+ +g kktL 71305 1 PGFRFNPTEEELVSFYLECKVRGKLNLPPGVILDVDFYHHDPWELS-GI-SNTKVFYFFVPRDRKYPDGSRPRRVARSGYWKATGTDHKVSDFRGKCIGKKKTL 102 8********************99666689**********8.44.345788******************************************** PP NAM 107 vfykgrapkgektdWvmheyrl 128 vfy+grapkg+kt+Wvm+e+rl 71305 103 VFYQGRAPKGNKTNWVMNEFRL 124 ******************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.62E-50	1	147	IPR003441	NAC domain
Pfam	PF02365	1.1E-24	1	124	IPR003441	NAC domain
PROSITE profile	PS51005	49.97	1	147	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 154 aa Download sequence Send to blast
PGFRFNPTEE ELVSFYLECK VRGKLNLPPG VILDVDFYHH DPWELSGISN TKVFYFFVPR 60 DRKYPDGSRP RRVARSGYWK ATGTDHKVSD FRGKCIGKKK TLVFYQGRAP KGNKTNWVMN 120 EFRLPWTDQP NSIAKEFDVT LCRMYQKSSS SQLQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-47	1	152	19	170	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-47	1	152	19	170	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-47	1	152	19	170	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-47	1	152	19	170	NO APICAL MERISTEM PROTEIN
3swm_A	4e-47	1	152	22	173	NAC domain-containing protein 19
3swm_B	4e-47	1	152	22	173	NAC domain-containing protein 19
3swm_C	4e-47	1	152	22	173	NAC domain-containing protein 19
3swm_D	4e-47	1	152	22	173	NAC domain-containing protein 19
3swp_A	4e-47	1	152	22	173	NAC domain-containing protein 19
3swp_B	4e-47	1	152	22	173	NAC domain-containing protein 19
3swp_C	4e-47	1	152	22	173	NAC domain-containing protein 19
3swp_D	4e-47	1	152	22	173	NAC domain-containing protein 19
4dul_A	4e-47	1	152	19	170	NAC domain-containing protein 19
4dul_B	4e-47	1	152	19	170	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269\|PubMed:15319476}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Strongly induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by cold treatment. Not induced by jasmonic acid. {ECO:0000269\|PubMed:15319476, ECO:0000269\|Ref.7}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024537209.1	1e-107	NAC transcription factor 32
Swissprot	Q93VY3	8e-47	NAC72_ARATH; NAC domain-containing protein 72
TrEMBL	D8QSZ3	1e-112	D8QSZ3_SELML; Uncharacterized protein (Fragment)
STRING	EFJ37025	1e-112	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G27410.2	3e-49	NAC family protein

Link Out ? help Back to Top
Phytozome	71305
Entrez Gene	9663271

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Zhu X, et al. Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes. Plant J., 2015. 84(3): p. 597-610 [PMID:26407000] Li S, et al. The role of ANAC072 in the regulation of chlorophyll degradation during age- and dark-induced leaf senescence. Plant Cell Rep., 2016. 35(8): p. 1729-41 [PMID:27154758] Ye H, et al. RD26 mediates crosstalk between drought and brassinosteroid signalling pathways. Nat Commun, 2017. 8: p. 14573 [PMID:28233777]