PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 72632
Common NameFLP-2, SELMODRAFT_86508
Organism
Selaginella moellendorffii
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB
Protein Properties Length: 96aa    MW: 11576.4 Da    PI: 10.817
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
72632genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-14141748
                     HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +Ede l ++vk++G++ W+ I+++m+ ++t+ +c+ rw++yl
            72632  1 QEDEMLRELVKRHGTKKWHIISAKMQ-NKTPRECRRRWRTYL 41
                     6*************************.*************97 PP
2Myb_DNA-binding53.65.3e-174789145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     + +W++eEd  l+++++ +G++ W+ Ia++++ gRt++ +k+r++
            72632 47 KSSWSAEEDRMLLEGHNAYGNR-WTEIAKMVP-GRTDNAVKNRFN 89
                     578*******************.*********.**********98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF002491.8E-13141IPR001005SANT/Myb domain
SMARTSM007171.8E-8143IPR001005SANT/Myb domain
PROSITE profilePS5129420.634145IPR017930Myb domain
SuperFamilySSF466895.14E-28188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-14146IPR009057Homeodomain-like
CDDcd001676.77E-11141No hitNo description
SMARTSM007171.5E-174694IPR001005SANT/Myb domain
PROSITE profilePS5129418.5024696IPR017930Myb domain
PfamPF002494.3E-164789IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-204795IPR009057Homeodomain-like
CDDcd001672.86E-114991No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
QEDEMLRELV KRHGTKKWHI ISAKMQNKTP RECRRRWRTY LHMCMNKSSW SAEEDRMLLE  60
GHNAYGNRWT EIAKMVPGRT DNAVKNRFNA LCKKRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-3119513107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB88, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:11536724, PubMed:9684356, PubMed:16155180, PubMed:24123248). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Also involved in the shape regulation of pavement cells (PubMed:9684356). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Promotes histone H3K27me3 marks and represses stem cell gene expression (PubMed:24654956). Required for lateral roots (LRs) initiation via the regulation of PIN3 expression in an auxin-dependent manner (PubMed:26578065). Involved in responses to gravity stimulation in primary roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells, thus modulating auxin asymmetric redistribution (PubMed:26578169). {ECO:0000269|PubMed:11536724, ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169, ECO:0000269|PubMed:9684356}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Strongly induced by auxin in a IAA14/SLR1 and ARF7 dependent manner, especially in xylem pole pericycle cells, lateral roots initiating cells. {ECO:0000269|PubMed:26578065}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024400443.14e-59transcription factor MYB3R-5-like isoform X1
RefseqXP_024400445.12e-59transcription factor MYB3R-5-like isoform X3
RefseqXP_024400446.12e-59transcription factor MYB3R-5-like isoform X3
SwissprotQ94FL62e-34MY124_ARATH; Transcription factor MYB124
TrEMBLD8R7W89e-66D8R7W8_SELML; Uncharacterized protein FLP-2 (Fragment)
STRINGEFJ319532e-66(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.29e-37MYB family protein
Publications ? help Back to Top
  1. Yang M,Sack FD
    The too many mouths and four lips mutations affect stomatal production in Arabidopsis.
    Plant Cell, 1995. 7(12): p. 2227-39
    [PMID:11536724]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Yang K, et al.
    Requirement for A-type cyclin-dependent kinase and cyclins for the terminal division in the stomatal lineage of Arabidopsis.
    J. Exp. Bot., 2014. 65(9): p. 2449-61
    [PMID:24687979]
  6. Yang M
    The FOUR LIPS (FLP) and MYB88 genes conditionally suppress the production of nonstomatal epidermal cells in Arabidopsis cotyledons.
    Am. J. Bot., 2016. 103(9): p. 1559-66
    [PMID:27620181]
  7. Xie Y, et al.
    An atypical R2R3 MYB transcription factor increases cold hardiness by CBF-dependent and CBF-independent pathways in apple.
    New Phytol., 2018. 218(1): p. 201-218
    [PMID:29266327]