PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

72682

Common Name

SELMODRAFT_72682

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

MYB_related

Protein Properties

Length: 94aa MW: 10933.6 Da PI: 10.7828

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
72682	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.6	1.4e-13	16	60	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +W eE++++++a +++ + Wk+I + +g +t q++s+ qky 72682 16 RENWADEEHDKFLEALHLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 60 789***************77.*****.***********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.35E-16	10	66	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.665	11	65	IPR017930	Myb domain
TIGRFAMs	TIGR01557	8.7E-18	14	63	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	6.3E-7	14	66	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-9	15	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.5E-11	16	60	IPR001005	SANT/Myb domain
CDD	cd00167	2.24E-7	18	61	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
DAARKIRKPY TITKSRENWA DEEHDKFLEA LHLFDRDWKK IEAFVGSKTV IQIRSHAQKY 60 FLKVQRNGTG EHVPPPRPKR KAALPYPQKA PKAG

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002960237.2	2e-63	protein REVEILLE 3
Refseq	XP_002967477.2	2e-63	protein REVEILLE 3
Swissprot	C0SVG5	5e-52	RVE5_ARATH; Protein REVEILLE 5
TrEMBL	D8QQE0	9e-63	D8QQE0_SELML; Uncharacterized protein (Fragment)
STRING	EFJ37776	1e-63	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP928	15	58

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01520.1	1e-43	MYB_related family protein

Link Out ? help Back to Top
Phytozome	72682
Entrez Gene	9641732

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size. Plant Physiol., 2017. 173(4): p. 2308-2322 [PMID:28254761]