![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 72886 | ||||||||
| Common Name | LEAFY, SELMODRAFT_417910 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | LFY | ||||||||
| Protein Properties | Length: 100aa MW: 11392.1 Da PI: 6.5379 | ||||||||
| Description | LFY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FLO_LFY | 125.1 | 9.3e-39 | 11 | 93 | 45 | 127 |
FLO_LFY 45 arklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaek 127
r++++l+elfk+yGvr++t+ak+ae+Gftv+tLv+m+d+el+d++k++ e ++++llvGe+yGik+a+raer++le++ +++
72886 11 RRDAKTLDELFKDYGVRITTLAKMAEMGFTVQTLVNMTDQELEDVIKTMLEGYHVELLVGEKYGIKSAIRAERKHLEDDLERQ 93
456899**********************************************************************9954322 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF01698 | 6.9E-29 | 1 | 94 | IPR002910 | Floricaula/leafy protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
PPPPPPPPPR RRDAKTLDEL FKDYGVRITT LAKMAEMGFT VQTLVNMTDQ ELEDVIKTML 60 EGYHVELLVG EKYGIKSAIR AERKHLEDDL ERQKSSSKAQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4ude_A | 1e-33 | 11 | 94 | 5 | 87 | GINLFY PROTEIN |
| 4ude_B | 1e-33 | 11 | 94 | 5 | 87 | GINLFY PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002966714.2 | 4e-64 | floricaula/leafy-like protein FL1 | ||||
| Refseq | XP_002978027.1 | 5e-64 | floricaula/leafy-like protein FL1 | ||||
| Swissprot | O04407 | 7e-34 | NEED_PINRA; Floricaula/leafy-like protein FL1 | ||||
| TrEMBL | D8R4X5 | 9e-67 | D8R4X5_SELML; Uncharacterized protein (Fragment) | ||||
| TrEMBL | D8S420 | 1e-62 | D8S420_SELML; Uncharacterized protein LEAFY | ||||
| STRING | EFJ20684 | 2e-63 | (Selaginella moellendorffii) | ||||
| STRING | EFJ32742 | 1e-67 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP19266 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G61850.1 | 2e-17 | floral meristem identity control protein LEAFY (LFY) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 72886 |
| Entrez Gene | 9658140 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




