![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 73105 | ||||||||
| Common Name | SELMODRAFT_73104, SELMODRAFT_73105 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | Nin-like | ||||||||
| Protein Properties | Length: 53aa MW: 6247.47 Da PI: 12.1021 | ||||||||
| Description | Nin-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | RWP-RK | 86.6 | 2.1e-27 | 5 | 53 | 2 | 50 |
RWP-RK 2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
+ +++++dl+++F+lpi++AAkeLg+c+TvLK+iCR++G++RWPhRk++
73105 5 TGKLKMSDLAQHFHLPINAAAKELGICPTVLKKICRRNGMRRWPHRKVR 53
5689*******************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51519 | 17.439 | 1 | 53 | IPR003035 | RWP-RK domain |
| Pfam | PF02042 | 1.2E-25 | 8 | 53 | IPR003035 | RWP-RK domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 53 aa Download sequence Send to blast |
QRERTGKLKM SDLAQHFHLP INAAAKELGI CPTVLKKICR RNGMRRWPHR KVR |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002983687.2 | 5e-32 | protein NLP1 | ||||
| Refseq | XP_024358580.1 | 1e-31 | uncharacterized protein LOC112273714 isoform X1 | ||||
| TrEMBL | D8RM22 | 3e-31 | D8RM22_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ05382 | 4e-32 | (Selaginella moellendorffii) | ||||
| STRING | EFJ26817 | 4e-32 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP567 | 17 | 77 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53040.1 | 7e-14 | RWP-RK domain-containing protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 73105 |
| Entrez Gene | 9650160 | 9663395 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




