PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

73112

Common Name

SELMODRAFT_73108, SELMODRAFT_73111, SELMODRAFT_73112

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Nin-like

Protein Properties

Length: 59aa MW: 7009.36 Da PI: 9.8926

Description

Nin-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
73112	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	RWP-RK	83.7	1.7e-26	5	53	4	52
RWP-RK 4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 +isledls+yF +pi++A+keL+v+ TvLK++C ++GI+RWPhRk+ksl 73112 5 DISLEDLSRYFTMPITQASKELKVSCTVLKKRCCEFGIPRWPHRKLKSL 53 89*********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51519	17.177	1	59	IPR003035	RWP-RK domain
Pfam	PF02042	6.0E-23	6	53	IPR003035	RWP-RK domain

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
ERMMDISLED LSRYFTMPIT QASKELKVSC TVLKKRCCEF GIPRWPHRKL KSLESLIHK

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024525129.1	4e-31	TPR-containing protein DDB_G0280363-like
Swissprot	O81791	3e-19	RKD5_ARATH; Protein RKD5
TrEMBL	D8RII0	2e-35	D8RII0_SELML; Uncharacterized protein (Fragment)
STRING	EFJ28251	3e-36	(Selaginella moellendorffii)
STRING	EFJ28254	3e-36	(Selaginella moellendorffii)
STRING	EFJ28256	3e-36	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP567	17	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35590.1	1e-21	RWP-RK domain-containing protein

Link Out ? help Back to Top
Phytozome	73112
Entrez Gene	9633194 \| 9641320 \| 9641322

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis. New Phytol., 2017. 213(4): p. 1909-1924 [PMID:27870062]