PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

73113

Common Name

SELMODRAFT_73113

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Nin-like

Protein Properties

Length: 59aa MW: 7058.36 Da PI: 10.2841

Description

Nin-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
73113	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	RWP-RK	89.7	2.3e-28	5	53	4	52
RWP-RK 4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 +isledls+yF +pi++A++eL+v+lTvLK+ CR++GI+RWPhRk+ksl 73113 5 DISLEDLSRYFTMPITQASNELKVGLTVLKKWCREFGIPRWPHRKLKSL 53 89*********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51519	17.803	1	59	IPR003035	RWP-RK domain
Pfam	PF02042	4.2E-23	6	53	IPR003035	RWP-RK domain

Sequence ? help Back to Top
Protein Sequence Length: 59 aa Download sequence Send to blast
ERMMDISLED LSRYFTMPIT QASNELKVGL TVLKKWCREF GIPRWPHRKL KSLESLIHK

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024525129.1	1e-32	TPR-containing protein DDB_G0280363-like
Swissprot	O81791	1e-21	RKD5_ARATH; Protein RKD5
TrEMBL	D8RII7	5e-36	D8RII7_SELML; Uncharacterized protein (Fragment)
STRING	EFJ28257	8e-37	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP567	17	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35590.1	6e-24	RWP-RK domain-containing protein

Link Out ? help Back to Top
Phytozome	73113
Entrez Gene	9641323

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis. New Phytol., 2017. 213(4): p. 1909-1924 [PMID:27870062]