PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

73117

Common Name

SELMODRAFT_73117

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

Nin-like

Protein Properties

Length: 54aa MW: 6387.62 Da PI: 10.4858

Description

Nin-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
73117	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	RWP-RK	73.6	2.6e-23	1	48	5	52
RWP-RK 5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 isledls+yF + i++A+keL+v+ TvLK++C ++GI+ WPhRk+ksl 73117 1 ISLEDLSRYFTMLITQASKELKVSRTVLKKRCCEFGIPQWPHRKLKSL 48 89********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF02042	8.4E-21	1	48	IPR003035	RWP-RK domain
PROSITE profile	PS51519	15.767	1	54	IPR003035	RWP-RK domain

Sequence ? help Back to Top
Protein Sequence Length: 54 aa Download sequence Send to blast
ISLEDLSRYF TMLITQASKE LKVSRTVLKK RCCEFGIPQW PHRKLKSLES LIHK

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002970926.2	2e-32	protein RKD1
Swissprot	O81791	4e-18	RKD5_ARATH; Protein RKD5
TrEMBL	D8RII2	4e-31	D8RII2_SELML; Uncharacterized protein (Fragment)
STRING	EFJ28252	6e-32	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP567	17	77

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35590.1	2e-20	RWP-RK domain-containing protein

Link Out ? help Back to Top
Phytozome	73117
Entrez Gene	9633195

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis. New Phytol., 2017. 213(4): p. 1909-1924 [PMID:27870062]