![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 73198 | ||||||||
| Common Name | SELMODRAFT_73198, SELMODRAFT_73199 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 56aa MW: 6516.31 Da PI: 10.0128 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 46.3 | 9.5e-15 | 1 | 52 | 1 | 52 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52
++e+kr r+++NRe+A+ sRqRKka+++ Lee+v +L a +L ++++ +
73198 1 DEEVKRKARLMRNRESAQLSRQRKKAYVDDLEERVRTLNATVAELNNTVSLI 52
5799************************************999998887765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 1.7E-5 | 1 | 56 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 8.7E-13 | 2 | 52 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 9.956 | 3 | 56 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 1.27E-12 | 5 | 54 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 2.9E-16 | 5 | 56 | No hit | No description |
| CDD | cd14704 | 5.60E-12 | 6 | 56 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0042538 | Biological Process | hyperosmotic salinity response | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005783 | Cellular Component | endoplasmic reticulum | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
DEEVKRKARL MRNRESAQLS RQRKKAYVDD LEERVRTLNA TVAELNNTVS LISAEN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds specifically to the DNA sequence 5'-TGACG-3'. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024522084.1 | 2e-29 | bZIP transcription factor 60-like | ||||
| Refseq | XP_024540899.1 | 2e-29 | bZIP transcription factor 60-like | ||||
| Swissprot | P14233 | 6e-16 | TGA1B_TOBAC; TGACG-sequence-specific DNA-binding protein TGA-1B (Fragment) | ||||
| TrEMBL | D8S9J8 | 5e-30 | D8S9J8_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ06284 | 9e-31 | (Selaginella moellendorffii) | ||||
| STRING | EFJ18972 | 9e-31 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP2171 | 16 | 28 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G40950.1 | 3e-17 | bZIP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 73198 |
| Entrez Gene | 9630533 | 9647095 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




