![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 74029 | ||||||||
| Common Name | MICPUN_74029 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 71aa MW: 7723.1 Da PI: 9.2094 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 49.3 | 1.1e-15 | 1 | 71 | 24 | 94 |
NF-YC 24 arikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvd 94
arikk+++ade+v +i+ +Pvl++ka e+f++el + a +t+ + a++ ++fdfl d
74029 1 ARIKKLMQADEEVGKIAQATPVLMAKALEMFMVELMKSTTDIASAHGAKTVSAGHLRASIMGNEKFDFLKD 71
7**********************************7666667788899*********************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.0E-21 | 1 | 71 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.7E-14 | 1 | 58 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 1.75E-18 | 1 | 71 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
ARIKKLMQAD EEVGKIAQAT PVLMAKALEM FMVELMKSTT DIASAHGAKT VSAGHLRASI 60 MGNEKFDFLK D |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1jfi_A | 1e-15 | 1 | 60 | 15 | 74 | Transcription Regulator NC2 alpha chain |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CP001324 | 1e-72 | CP001324.1 Micromonas sp. RCC299 chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002500616.1 | 1e-44 | predicted protein, partial | ||||
| Swissprot | Q6C6M5 | 1e-22 | DPB3_YARLI; DNA polymerase epsilon subunit C | ||||
| TrEMBL | C1E288 | 2e-43 | C1E288_MICCC; Uncharacterized protein (Fragment) | ||||
| STRING | XP_002500616.1 | 4e-44 | (Micromonas sp. RCC299) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP3343 | 13 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G19490.1 | 2e-20 | NF-YC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 74029 |
| Entrez Gene | 8242231 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




