PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information? help Back to Top

TF ID

74650

Common Name

MICPUN_74650

Organism

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas

Family

Protein Properties

Length: 95aa MW: 10834.5 Da PI: 11.1031

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
74650	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	37.2	6.9e-12	1	40	7	47
HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +Ed +l +v +G ++W+ Ia+ ++ R+ k+c++rw + 74650 1 QEDARLSMLVMTHGARNWSFIAEGIP-SRSSKSCRLRWCNQ 40 69**********************.*********985 PP
2	Myb_DNA-binding	45.9	1.3e-14	47	89	1	45
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 r++++ Ed + a k+lG++ W++Ia+ ++ gRt++ +k++++ 74650 47 RDNFSDAEDRTIMAAYKKLGNR-WASIAKLLP-GRTDNAVKNHLH 89 789*****************.*****.********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00167	2.09E-9	1	39	No hit	No description
PROSITE profile	PS51294	13.717	1	41	IPR017930	Myb domain
SMART	SM00717	1.2E-4	1	43	IPR001005	SANT/Myb domain
Pfam	PF13921	7.2E-14	1	56	No hit	No description
SuperFamily	SSF46689	1.46E-23	1	87	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	7.2E-20	1	48	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.438	42	95	IPR017930	Myb domain
SMART	SM00717	5.8E-10	46	94	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.8E-18	49	90	IPR009057	Homeodomain-like
CDD	cd00167	2.59E-8	49	87	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
QEDARLSMLV MTHGARNWSF IAEGIPSRSS KSCRLRWCNQ LDPALRRDNF SDAEDRTIMA 60 AYKKLGNRWA SIAKLLPGRT DNAVKNHLHA KLRAK

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by salicylic acid. {ECO:0000269\|PubMed:16463103}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP001323	1e-158	CP001323.1 Micromonas sp. RCC299 chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002500273.1	3e-65	predicted protein, partial
Swissprot	Q42575	1e-35	MYB1_ARATH; Transcription factor MYB1
TrEMBL	C1DZ20	6e-64	C1DZ20_MICCC; Uncharacterized protein (Fragment)
STRING	XP_002500273.1	1e-64	(Micromonas sp. RCC299)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP15	16	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G55730.1	7e-39	myb domain protein 109

Link Out ? help Back to Top
Phytozome	74650
Entrez Gene	8240975

Publications ? help Back to Top
Worden AZ, et al. Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas. Science, 2009. 324(5924): p. 268-72 [PMID:19359590] Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Nguyen HT, et al. A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2. Plant Cell Physiol., 2016. 57(4): p. 784-97 [PMID:26872838] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]