PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

7686

Common Name

SELMODRAFT_414867

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

NF-YC

Protein Properties

Length: 78aa MW: 8682.17 Da PI: 8.2215

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
7686	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	56.1	8.4e-18	1	75	24	98
NF-YC 24 arikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 arikki++ade+v +i+ +Pvl+ska elf+ +l +++ + +t+ s ++++v+ +fdfl +iv + 7686 1 ARIKKIMQADEEVGKIALATPVLISKALELFLQDLCDKTYEITLGRGAKTMSSSHLKQCVQTNSVFDFLREIVSK 75 7**********************************************************************9976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00808	7.2E-17	1	60	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
Gene3D	G3DSA:1.10.20.10	1.2E-24	1	74	IPR009072	Histone-fold
SuperFamily	SSF47113	1.13E-20	7	77	IPR009072	Histone-fold

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0005829	Cellular Component	cytosol
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
ARIKKIMQAD EEVGKIALAT PVLISKALEL FLQDLCDKTY EITLGRGAKT MSSSHLKQCV 60 QTNSVFDFLR EIVSKVPD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1jfi_A	4e-23	1	61	15	75	Transcription Regulator NC2 alpha chain
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002963680.2	1e-49	dr1-associated corepressor
Refseq	XP_002974769.1	1e-49	dr1-associated corepressor isoform X1
Swissprot	Q14919	3e-28	NC2A_HUMAN; Dr1-associated corepressor
Swissprot	Q2YDP3	3e-28	NC2A_BOVIN; Dr1-associated corepressor
TrEMBL	D8QY56	6e-50	D8QY56_SELML; Uncharacterized protein (Fragment)
TrEMBL	D8RUW5	3e-48	D8RUW5_SELML; Uncharacterized protein
STRING	EFJ24289	5e-49	(Selaginella moellendorffii)
STRING	EFJ35551	1e-50	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP2179	16	35

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G12480.1	1e-42	nuclear factor Y, subunit C11

Link Out ? help Back to Top
Phytozome	7686
Entrez Gene	9636702

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]