![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 77573 | ||||||||
| Common Name | SELMODRAFT_77573 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 95aa MW: 10892.7 Da PI: 7.5244 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 155.6 | 8.7e-49 | 1 | 88 | 15 | 102 |
NF-YC 15 dfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
dfk h+lPlarikki+kadedvkmisaeaPvl++kacelfilelt+r+w+h+eenkrrtl+++d+a a++r+difdflvdivpr+elk
77573 1 DFKTHQLPLARIKKIMKADEDVKMISAEAPVLFAKACELFILELTFRAWMHTEENKRRTLQRNDVAGAISRADIFDFLVDIVPREELK 88
8***********************************************************************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 2.68E-30 | 1 | 78 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.7E-22 | 6 | 69 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 6.7E-38 | 7 | 84 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
DFKTHQLPLA RIKKIMKADE DVKMISAEAP VLFAKACELF ILELTFRAWM HTEENKRRTL 60 QRNDVAGAIS RADIFDFLVD IVPREELKVT FLST* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 9e-49 | 1 | 84 | 12 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 56 | 62 | RRTLQRN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002961501.2 | 2e-59 | nuclear transcription factor Y subunit C-2 | ||||
| Swissprot | Q9FMV5 | 4e-52 | NFYC4_ARATH; Nuclear transcription factor Y subunit C-4 | ||||
| TrEMBL | D8QRD2 | 1e-61 | D8QRD2_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ36761 | 2e-62 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP315 | 17 | 117 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G63470.2 | 2e-54 | nuclear factor Y, subunit C4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 77573 |
| Entrez Gene | 9630115 |




