PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

78481

Common Name

SELMODRAFT_78481

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

MYB_related

Protein Properties

Length: 69aa MW: 8140.43 Da PI: 10.6192

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
78481	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59	1e-18	12	56	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r rWT+eE+ ++v+a +++G g W++I +++g ++t+ q++s+ qk+ 78481 12 RERWTEEEHIKFVEALQLFGRG-WRKIEEHIG-TKTAVQIRSHAQKF 56 78******************.*****.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	3.96E-18	6	59	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.552	7	61	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	7.1E-10	8	57	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.8E-18	10	59	IPR006447	Myb domain, plants
SMART	SM00717	5.4E-12	11	59	IPR001005	SANT/Myb domain
Pfam	PF00249	7.2E-16	12	55	IPR001005	SANT/Myb domain
CDD	cd00167	2.95E-9	14	57	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 69 aa Download sequence Send to blast
QVRKPYTITK QRERWTEEEH IKFVEALQLF GRGWRKIEEH IGTKTAVQIR SHAQKFFSKV 60 CFTAFCGK*

Functional Description ? help Back to Top
Source	Description
UniProt	Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23240770}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269\|PubMed:19805390, ECO:0000269\|PubMed:23240770}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024514747.1	3e-36	protein REVEILLE 2 isoform X3
Refseq	XP_024518337.1	3e-36	protein REVEILLE 2-like isoform X3
Swissprot	F4KGY6	2e-30	RVE1_ARATH; Protein REVEILLE 1
TrEMBL	D8QU17	8e-42	D8QU17_SELML; Uncharacterized protein (Fragment)
STRING	EFJ35791	1e-42	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP1255	15	49

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G17300.1	8e-33	MYB_related family protein

Link Out ? help Back to Top
Phytozome	78481
Entrez Gene	9661755

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xu G, et al. REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis. Photosyn. Res., 2015. 126(2-3): p. 331-40 [PMID:25910753] Jiang Z,Xu G,Jing Y,Tang W,Lin R Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis. Nat Commun, 2016. 7: p. 12377 [PMID:27506149]