![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 78481 | ||||||||
| Common Name | SELMODRAFT_78481 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 69aa MW: 8140.43 Da PI: 10.6192 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 59 | 1e-18 | 12 | 56 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
r rWT+eE+ ++v+a +++G g W++I +++g ++t+ q++s+ qk+
78481 12 RERWTEEEHIKFVEALQLFGRG-WRKIEEHIG-TKTAVQIRSHAQKF 56
78********************.*********.************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 3.96E-18 | 6 | 59 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 19.552 | 7 | 61 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.1E-10 | 8 | 57 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.8E-18 | 10 | 59 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 5.4E-12 | 11 | 59 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 7.2E-16 | 12 | 55 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.95E-9 | 14 | 57 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 69 aa Download sequence Send to blast |
QVRKPYTITK QRERWTEEEH IKFVEALQLF GRGWRKIEEH IGTKTAVQIR SHAQKFFSKV 60 CFTAFCGK* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Morning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024514747.1 | 3e-36 | protein REVEILLE 2 isoform X3 | ||||
| Refseq | XP_024518337.1 | 3e-36 | protein REVEILLE 2-like isoform X3 | ||||
| Swissprot | F4KGY6 | 2e-30 | RVE1_ARATH; Protein REVEILLE 1 | ||||
| TrEMBL | D8QU17 | 8e-42 | D8QU17_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ35791 | 1e-42 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP1255 | 15 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G17300.1 | 8e-33 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 78481 |
| Entrez Gene | 9661755 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




