PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

79393

Common Name

MADS2-2, SELMODRAFT_451128

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

M-type_MADS

Protein Properties

Length: 63aa MW: 7043.26 Da PI: 10.7083

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
79393	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	84.9	4.8e-27	9	55	1	47
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47 k+ien+ rqvt+skRrng++KKA+ELS+LCd++va+i+fs+ gkl 79393 9 KKIENHQARQVTYSKRRNGLMKKAFELSTLCDTDVALIMFSPAGKLS 55 78*******************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.3E-32	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	26.282	1	54	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.02E-26	2	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-23	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.0E-25	10	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-23	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-23	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 63 aa Download sequence Send to blast
MGRVKLEIKK IENHQARQVT YSKRRNGLMK KAFELSTLCD TDVALIMFSP AGKLSIHPND 60 GR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
1tqe_R	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
1tqe_S	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
6c9l_A	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
6c9l_B	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
6c9l_C	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
6c9l_D	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
6c9l_E	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
6c9l_F	2e-16	1	54	1	54	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FM999807	1e-102	Selaginella moellendorffii mRNA for MADS3 protein, allele 1
GenBank	FM999808	1e-102	Selaginella moellendorffii mRNA for MADS3 protein, allele 2

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024524066.1	3e-35	MADS-box transcription factor 6 isoform X1
Swissprot	Q9LM46	2e-22	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	D8QY82	8e-35	D8QY82_SELML; MADS-domain transcription factor
TrEMBL	D8RTW9	3e-34	D8RTW9_SELML; MADS-domain transcription factor
TrEMBL	H1ZSL9	4e-38	H1ZSL9_9TRAC; MADS3 protein (Fragment)
STRING	EFJ24305	5e-35	(Selaginella moellendorffii)
STRING	EFJ35566	1e-35	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22130.1	6e-25	AGAMOUS-like 104

Link Out ? help Back to Top
Phytozome	79393
Entrez Gene	9637245

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]