PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

79699

Common Name

SELMODRAFT_79699

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

SBP

Protein Properties

Length: 87aa MW: 10112.5 Da PI: 9.2449

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
79699	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	130.6	5.5e-41	8	85	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +C+v+gC +dls+a +yhrrhkvC+ h+ p+v+ +g+eqrfCqqCsrfh+lsefDe+krsCr+rLa+hnerrr++q+ 79699 8 CCRVDGCGEDLSTAGDYHRRHKVCKLHATLPKVMNHGQEQRFCQQCSRFHSLSEFDEGKRSCRKRLAGHNERRRRHQP 85 6**************************************************************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	2.2E-33	6	70	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	30.983	6	83	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.7E-37	7	86	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.5E-32	9	82	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MPVLPVPCCR VDGCGEDLST AGDYHRRHKV CKLHATLPKV MNHGQEQRFC QQCSRFHSLS 60 EFDEGKRSCR KRLAGHNERR RRHQPDS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	5e-29	9	82	11	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002963433.2	5e-57	squamosa promoter-binding-like protein 15 isoform X1
Refseq	XP_024524017.1	2e-57	uncharacterized protein LOC9655427 isoform X2
Refseq	XP_024524018.1	2e-57	uncharacterized protein LOC9655427 isoform X3
Swissprot	Q700C2	1e-32	SPL16_ARATH; Squamosa promoter-binding-like protein 16
TrEMBL	D8QWW0	1e-57	D8QWW0_SELML; Uncharacterized protein (Fragment)
STRING	EFJ35304	2e-58	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP97	17	230

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G76580.1	6e-35	SBP family protein

Link Out ? help Back to Top
Phytozome	79699
Entrez Gene	9655427

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]