![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 856033 | ||||||||
| Common Name | ARALYDRAFT_482436 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 173aa MW: 19783.2 Da PI: 9.6686 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 100.6 | 1.5e-31 | 98 | 154 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Rakle++++ +k++kpy+heSRh hA+rRpRg+gGrF
856033 98 EEPVFVNAKQYHGILRRRQSRAKLEARNRA-IKAKKPYMHESRHLHAIRRPRGCGGRF 154
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 2.9E-35 | 96 | 157 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.988 | 97 | 157 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.6E-26 | 99 | 154 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 8.2E-24 | 100 | 122 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 102 | 122 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 8.2E-24 | 131 | 154 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 173 aa Download sequence Send to blast |
MTSSVHELSD NNESHGKKER PDSQTRPQIP SGRSSESIDT TNSVYSEPMA HGLYPYPDPY 60 YRSIFSQQAY LPHPYPGVQL QLMGMQQPGV PLQCDAVEEP VFVNAKQYHG ILRRRQSRAK 120 LEARNRAIKA KKPYMHESRH LHAIRRPRGC GGRFLNAKKK NGDHKEEEEE TTS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-20 | 97 | 167 | 1 | 71 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 856033 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY072414 | 0.0 | AY072414.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds. | |||
| GenBank | AY114711 | 0.0 | AY114711.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020885641.1 | 1e-128 | nuclear transcription factor Y subunit A-4 | ||||
| Refseq | XP_020885642.1 | 1e-128 | nuclear transcription factor Y subunit A-4 | ||||
| Swissprot | Q8VY64 | 1e-122 | NFYA4_ARATH; Nuclear transcription factor Y subunit A-4 | ||||
| TrEMBL | D7LH39 | 1e-127 | D7LH39_ARALL; CCAAT-binding transcription factor (CBF-B/NF-YA) family protein | ||||
| STRING | fgenesh2_kg.4__1496__AT2G34720.1 | 1e-128 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4168 | 27 | 56 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G34720.1 | 1e-125 | nuclear factor Y, subunit A4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 856033 |
| Entrez Gene | 9317421 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




