![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 856498 | ||||||||
| Common Name | ARALYDRAFT_655942 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 102aa MW: 12316.8 Da PI: 10.9269 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 21.8 | 4.5e-07 | 38 | 77 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+T++E++l+ + ++ G + W++Ia ++ gR ++++ +w
856498 38 MTEQEEDLISRMYRLVGDR-WDLIAGRVV-GRKANEIERFWI 77
79***************99.*********.*********995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 2.8E-4 | 34 | 82 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 9.68E-5 | 37 | 76 | No hit | No description |
| Pfam | PF00249 | 1.9E-6 | 38 | 77 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.4E-9 | 39 | 77 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 3.59E-6 | 39 | 86 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0080147 | Biological Process | root hair cell development | ||||
| GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MDNTNRLRRG RSFRQTKFTR SRHDSEEVSS IEWEFISMTE QEEDLISRMY RLVGDRWDLI 60 AGRVVGRKAN EIERFWIMRN SDFFSHKRRH FNNSPFFSSP P* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15604688, ECO:0000269|PubMed:19818620}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 856498 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY234411 | 1e-105 | AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds. | |||
| GenBank | AY519520 | 1e-105 | AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds. | |||
| GenBank | AY649255 | 1e-105 | AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002862821.1 | 2e-68 | MYB-like transcription factor ETC2 | ||||
| Swissprot | Q84RD1 | 5e-61 | ETC2_ARATH; MYB-like transcription factor ETC2 | ||||
| TrEMBL | D7MWK3 | 4e-67 | D7MWK3_ARALL; Predicted protein | ||||
| STRING | Al_scaffold_0136_3 | 6e-68 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30420.1 | 2e-63 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 856498 |
| Entrez Gene | 9298898 |




