![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 859602 | ||||||||
| Common Name | ARALYDRAFT_659046 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 86aa MW: 10090 Da PI: 10.1675 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 53.1 | 4e-17 | 10 | 53 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
r e+ r+ +skR++g++KKAeE+ LCd e+ +i++s+t+k
859602 10 RLESLKERSSKYSKRKKGLFKKAEEVAMLCDCEIILIVVSPTDK 53
5678889999*******************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.3E-23 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 20.815 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.06E-22 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 1.13E-19 | 2 | 84 | No hit | No description |
| PRINTS | PR00404 | 6.6E-14 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.7E-16 | 12 | 55 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-14 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.6E-14 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MGRKKIKLNR LESLKERSSK YSKRKKGLFK KAEEVAMLCD CEIILIVVSP TDKPTIFHTR 60 SKSFSKIYER YCMLSLQERE ERCDL* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 859602 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002870417.2 | 5e-52 | agamous-like MADS-box protein AGL66 | ||||
| TrEMBL | D7MHP6 | 1e-53 | D7MHP6_ARALL; Predicted protein | ||||
| STRING | Al_scaffold_0007_3101 | 2e-54 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7330 | 18 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26320.1 | 1e-35 | AGAMOUS-like 33 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 859602 |
| Entrez Gene | 9304479 |




