![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 859664 | ||||||||
| Common Name | ARALYDRAFT_659108 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 109aa MW: 12024.2 Da PI: 5.0905 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 51.5 | 2e-16 | 78 | 107 | 1 | 30 |
---SS-EEEEEEE--TT-SS-EEEEEE-ST CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsa 30
++DgynWr YGqK vkg+e +rsYY+Ct++
859664 78 MQDGYNWRIYGQKLVKGNELTRSYYKCTQP 107
58**************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF13456 | 3.7E-10 | 6 | 63 | No hit | No description |
| PROSITE profile | PS50811 | 14.458 | 73 | 108 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.53E-13 | 74 | 107 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 3.0E-13 | 75 | 107 | IPR003657 | WRKY domain |
| SMART | SM00774 | 1.3E-4 | 78 | 108 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 5.2E-11 | 79 | 106 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MDSLNVTGGW LIRDHSGFTK SLASASLSQA ASPLEAETRS LLAASQHTWE RGFSDVIFEG 60 DCESGSEGNN PFIRENVMQD GYNWRIYGQK LVKGNELTRS YYKCTQPN* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 859664 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC237327 | 1e-101 | AC237327.1 Arabidopsis lyrata clone JGIFAFI-37B11, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | D7MHV1 | 7e-76 | D7MHV1_ARALL; Predicted protein | ||||
| STRING | Al_scaffold_0007_3163 | 1e-76 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7949 | 26 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G04880.1 | 1e-23 | zinc-dependent activator protein-1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 859664 |
| Entrez Gene | 9304507 |




