![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 863107 | ||||||||
| Common Name | ARALYDRAFT_662551 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 124aa MW: 13568.9 Da PI: 10.1973 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 61.7 | 9.1e-20 | 28 | 62 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs C+ttkTp+WR gp g+k+LCnaCG+++rk+++
863107 28 CSDCKTTKTPMWRGGPTGPKSLCNACGIRFRKQRR 62
********************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 2.9E-13 | 21 | 63 | No hit | No description |
| SMART | SM00401 | 5.0E-16 | 22 | 85 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 12.453 | 22 | 58 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 4.4E-16 | 26 | 62 | IPR013088 | Zinc finger, NHR/GATA-type |
| Pfam | PF00320 | 8.3E-18 | 28 | 62 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 28 | 53 | IPR000679 | Zinc finger, GATA-type |
| CDD | cd00202 | 8.73E-11 | 28 | 62 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009416 | Biological Process | response to light stimulus | ||||
| GO:0048527 | Biological Process | lateral root development | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 124 aa Download sequence Send to blast |
MDSRKLLSCS SSYMSTRMEE EKETVRCCSD CKTTKTPMWR GGPTGPKSLC NACGIRFRKQ 60 RRSELLGICI IHSHQGLASK KIKPKSSSLS SHGGVAVKKR RSLKEEEQAA LCLLLLSCSS 120 VFA* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 863107 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY086778 | 1e-114 | AY086778.1 Arabidopsis thaliana clone 27625 mRNA, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002872245.1 | 6e-84 | GATA transcription factor 23 | ||||
| Swissprot | Q8LC59 | 3e-56 | GAT23_ARATH; GATA transcription factor 23 | ||||
| TrEMBL | D7M5E6 | 1e-82 | D7M5E6_ARALL; Predicted protein | ||||
| STRING | Al_scaffold_0006_2616 | 2e-83 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM14484 | 16 | 22 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 3e-54 | GATA transcription factor 23 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 863107 |
| Entrez Gene | 9308314 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




