PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

89227

Common Name

SELMODRAFT_104521, SELMODRAFT_89227

Organism

Selaginella moellendorffii

Taxonomic ID

88036

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

TCP

Protein Properties

Length: 86aa MW: 9694.16 Da PI: 10.9313

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
89227	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	108	1.5e-33	11	73	2	64
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltg 64 g+kdrhsk+ T++g+RdRRvRls+++a++f+d+qd+LG+d++sk++eWL+++ak ai+el + 89227 11 SGGKDRHSKVFTAKGPRDRRVRLSVSTAIQFYDVQDRLGYDQPSKAVEWLMKKAKNAIDELSQ 73 689*********************************************************975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	9.1E-33	12	73	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	32.855	13	71	IPR017887	Transcription factor TCP subgroup

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009637	Biological Process	response to blue light
GO:0009965	Biological Process	leaf morphogenesis
GO:0030154	Biological Process	cell differentiation
GO:0045962	Biological Process	positive regulation of development, heterochronic
GO:1903508	Biological Process	positive regulation of nucleic acid-templated transcription
GO:2000306	Biological Process	positive regulation of photomorphogenesis

Sequence ? help Back to Top
Protein Sequence Length: 86 aa Download sequence Send to blast
MNISARTLRP SGGKDRHSKV FTAKGPRDRR VRLSVSTAIQ FYDVQDRLGY DQPSKAVEWL 60 MKKAKNAIDE LSQIPLPGID RLTLPS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5zkt_A	2e-25	18	71	1	54	Putative transcription factor PCF6
5zkt_B	2e-25	18	71	1	54	Putative transcription factor PCF6
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269\|PubMed:12931144, ECO:0000269\|PubMed:17307931, ECO:0000269\|PubMed:25378179, ECO:0000269\|PubMed:26596765}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00006	PBM	Transfer from 493022	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269\|PubMed:12931144, ECO:0000269\|PubMed:26596765}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024529105.1	2e-53	uncharacterized protein LOC112345826
Refseq	XP_024529106.1	2e-53	uncharacterized protein LOC112345826
Refseq	XP_024536722.1	1e-53	AF4/FMR2 family member 4-like
Refseq	XP_024536723.1	1e-53	AF4/FMR2 family member 4-like
Swissprot	Q93V43	4e-32	TCP2_ARATH; Transcription factor TCP2
TrEMBL	D8RBQ3	3e-56	D8RBQ3_SELML; Uncharacterized protein (Fragment)
STRING	EFJ22810	5e-57	(Selaginella moellendorffii)
STRING	EFJ30830	5e-57	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP180	15	163

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18390.2	2e-34	TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2

Link Out ? help Back to Top
Phytozome	89227
Entrez Gene	9631463 \| 9646187

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375]