![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 892661 | ||||||||
| Common Name | ARALYDRAFT_892661 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 78aa MW: 9083.61 Da PI: 10.5668 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 60.1 | 4.4e-19 | 8 | 68 | 2 | 62 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
++ +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le+ N++L ke+ee +ke +k ++
892661 8 AAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEGNEKLLKEIEESTKERYKKLMD 68
5789**************************************************9998776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 1.1E-14 | 5 | 62 | No hit | No description |
| SMART | SM00338 | 4.6E-13 | 7 | 71 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 2.9E-18 | 8 | 68 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.634 | 9 | 61 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.06E-11 | 11 | 63 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 14 | 29 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MTKAMDKAAA QRQKRMIKNR ESAARSRERK QAYQVELETL AAKLEEGNEK LLKEIEESTK 60 ERYKKLMDVL IPFSKRL* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 892661 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC003027 | 3e-89 | AC003027.1 Arabidopsis thaliana chromosome I BAC F21M11 genomic sequence, complete sequence. | |||
| GenBank | AY087603 | 3e-89 | AY087603.1 Arabidopsis thaliana clone 36980 mRNA, complete sequence. | |||
| GenBank | BT024495 | 3e-89 | BT024495.1 Arabidopsis thaliana At1g03970 mRNA, complete cds. | |||
| GenBank | CP002684 | 3e-89 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| GenBank | U01823 | 3e-89 | U01823.1 Arabidopsis thaliana Columbia bZIP protein GBF4 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002894569.2 | 2e-47 | G-box-binding factor 4 | ||||
| Swissprot | P42777 | 8e-38 | GBF4_ARATH; G-box-binding factor 4 | ||||
| TrEMBL | D7KNY1 | 8e-46 | D7KNY1_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_105455.1 | 1e-46 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3852 | 28 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G03970.1 | 2e-29 | G-box binding factor 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 892661 |
| Entrez Gene | 9330630 |




