![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 893617 | ||||||||
| Common Name | ARALYDRAFT_893617 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 118aa MW: 13363 Da PI: 9.8368 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 86 | 3.9e-27 | 24 | 76 | 3 | 55 |
G2-like 3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
r +W++eLH++F++a++qLGG++kA+Pk+il m+v+gLt+ +v+ HLQkYRl
893617 24 RFVWSHELHQKFLNAIDQLGGNDKAIPKKILADMNVEGLTRLNVATHLQKYRL 76
899*************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.352 | 19 | 79 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.8E-25 | 19 | 80 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.06E-17 | 22 | 80 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 6.4E-24 | 24 | 76 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 1.2E-6 | 26 | 75 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MGDFKSIEDP EIVQESRTRK NHGRFVWSHE LHQKFLNAID QLGGNDKAIP KKILADMNVE 60 GLTRLNVATH LQKYRLTLER TTEAQQLNMA TRQVPSFIQQ GHHQNSSNSA NPSESRT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1irz_A | 5e-18 | 24 | 82 | 7 | 64 | ARR10-B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 893617 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002888195.1 | 1e-83 | two-component response regulator ARR18 | ||||
| Swissprot | Q9FGT7 | 4e-27 | ARR18_ARATH; Two-component response regulator ARR18 | ||||
| TrEMBL | D7KXU1 | 3e-82 | D7KXU1_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_200691.1 | 5e-83 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM23198 | 2 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G58080.1 | 1e-29 | response regulator 18 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 893617 |
| Entrez Gene | 9322738 |




