![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 893630 | ||||||||
| Common Name | ARALYDRAFT_893630 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | BBR-BPC | ||||||||
| Protein Properties | Length: 56aa MW: 6401.47 Da PI: 11.5057 | ||||||||
| Description | BBR-BPC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GAGA_bind | 91.5 | 2.9e-28 | 1 | 55 | 247 | 301 |
GAGA_bind 247 stkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
++++r++R+ grK+S+ + ++lL++La eG++ls p+DLkd+W +HGtn+++ti+
893630 1 MPNKRHSRVCGRKVSGIVLSRLLSRLAREGHELSSPLDLKDYWVRHGTNRYITIK 55
79****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF06217 | 5.4E-25 | 1 | 55 | IPR010409 | GAGA-binding transcriptional activator |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
MPNKRHSRVC GRKVSGIVLS RLLSRLAREG HELSSPLDLK DYWVRHGTNR YITIK* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 893630 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020875421.1 | 2e-26 | protein BASIC PENTACYSTEINE5 isoform X1 | ||||
| Refseq | XP_020875422.1 | 1e-26 | protein BASIC PENTACYSTEINE5 isoform X2 | ||||
| Swissprot | F4JUI3 | 7e-27 | BPC5_ARATH; Protein BASIC PENTACYSTEINE5 | ||||
| TrEMBL | D7KXV6 | 5e-32 | D7KXV6_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_200704.1 | 8e-33 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM30335 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G38910.1 | 2e-29 | basic pentacysteine 5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 893630 |
| Entrez Gene | 9324269 |




