![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 896042 | ||||||||
| Common Name | ARALYDRAFT_896042 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 163aa MW: 18935.3 Da PI: 9.5508 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 99.9 | 1.6e-31 | 82 | 140 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+++fprsYY+Ct +gC+vkk+v+r d+ vv++tY+g H+h+
896042 82 LDDGYRWRKYGQKAVKNNPFPRSYYKCTEEGCRVKKQVQRLWGDEGVVVTTYQGVHTHP 140
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 7.7E-33 | 67 | 140 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 8.37E-29 | 74 | 141 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.125 | 77 | 142 | IPR003657 | WRKY domain |
| SMART | SM00774 | 4.2E-37 | 82 | 141 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.1E-25 | 83 | 140 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0006817 | Biological Process | phosphate ion transport | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008134 | Molecular Function | transcription factor binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MEDRRCQVLF PCSSSVDPRL TEYHGVDNSA ECADQLTTSS LSQQNMNTNE EEKPKSKKKK 60 KKKKKEREAR YAFQTRSQVD ILDDGYRWRK YGQKAVKNNP FPRSYYKCTE EGCRVKKQVQ 120 RLWGDEGVVV TTYQGVHTHP VDKPSDNFNH ILTQMHIFPP FS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-27 | 72 | 139 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-27 | 72 | 139 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 56 | 64 | KKKKKKKKK |
| 2 | 58 | 64 | KKKKKKK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00325 | DAP | Transfer from AT3G01970 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 896042 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF426251 | 1e-136 | AF426251.1 Arabidopsis thaliana WRKY transcription factor 45 (WRKY45) mRNA, complete cds. | |||
| GenBank | AK118457 | 1e-136 | AK118457.1 Arabidopsis thaliana At3g01970 mRNA for putative WRKY-like transcriptional regulator protein, complete cds, clone: RAFL19-70-A15. | |||
| GenBank | AY085246 | 1e-136 | AY085246.1 Arabidopsis thaliana clone 1415 mRNA, complete sequence. | |||
| GenBank | BT024684 | 1e-136 | BT024684.1 Arabidopsis thaliana At3g01970 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002882154.1 | 1e-121 | probable WRKY transcription factor 45 | ||||
| Swissprot | Q9S763 | 8e-84 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
| TrEMBL | D7L9J2 | 1e-119 | D7L9J2_ARALL; Uncharacterized protein | ||||
| STRING | scaffold_300012.1 | 1e-120 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM509 | 28 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G01970.1 | 7e-85 | WRKY DNA-binding protein 45 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 896042 |
| Entrez Gene | 9318221 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




